The domain within your query sequence starts at position 106 and ends at position 214; the E-value for the Methyltransf_24 domain shown below is 6.2e-14.

LELGAYCGYSAVRMARLLPPGARLLTMEINPDYAAITQQMLDFAGLQDKVSILIGASQDL
IPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNV

Methyltransf_24

Methyltransf_24
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Methyltransf_24