The domain within your query sequence starts at position 177 and ends at position 279; the E-value for the Methyltransf_25 domain shown below is 7.6e-12.

ILEVGCGVGNTVFPILQTNNNPNLFVYCCDFSATAIELLKTNSQYDPSRCYAFVHDLCDE
DQSYPVPEDSLDVIVLIFVLSAIVPDKMQKAISKLSRLLKPGG

Methyltransf_25

Methyltransf_25
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Methyltransf_25