The domain within your query sequence starts at position 31 and ends at position 133; the E-value for the Methyltransf_25 domain shown below is 9e-8.

VLEVASGSGQHAAHFAQAFPNAEWQPSDVDQRCLDSIAATTRAQGLSNVKAPLYLDVTWE
WEQWGGIPPRSLDLLLCINMIHISPLNCTEGLFRAAGHLLKTK

Methyltransf_25

Methyltransf_25
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Methyltransf_25