The domain within your query sequence starts at position 337 and ends at position 444; the E-value for the Methyltransf_25 domain shown below is 2.5e-7.
LLDICCGTGVIGLSVAQRASQVHGIELVEQAVEDARWTAAFNGVTNCEFHAGRAETILPQ LLKSQKDEKLTVAVVNPARAGLHYRVVRAIRNCRTIHTLVFVSCKPHG
Methyltransf_25 |
---|
PFAM accession number: | PF13649 |
---|---|
Interpro abstract (IPR041698): | This is a methyltransferase domain is a member of a Pfam clan that includes Rossmann-fold domains. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Methyltransf_25