The domain within your query sequence starts at position 71 and ends at position 171; the E-value for the Methyltransf_26 domain shown below is 3.7e-9.

DKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEE
VELPVEKVDIIISEWMGYCLFYESMLNTVLHARDKWLAPDG

Methyltransf_26

Methyltransf_26
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Methyltransf_26