The domain within your query sequence starts at position 45 and ends at position 196; the E-value for the Methyltransf_29 domain shown below is 7.1e-8.
NIFDRELKRKQKNWAARQPDPMKFDYLKEEVGSRIADRVYDIARDFPLALDIGCGRGYIA QHLDKETVGKIFQTDIAEHALKNSLETDIPTVNILADEEFLPFQENTFDLVVSSLSLHWV NDLPRALEQIHYVLKPDGVFVGAMFGGDTLYE
Methyltransf_29 |
---|
PFAM accession number: | PF03141 |
---|---|
Interpro abstract (IPR004159): | This is a family of putative S-adenosyl-L-methionine (SAM)-dependent methyltransferase [ (PUBMED:17461780) (PUBMED:18167546) (PUBMED:17425712) ]. |
GO function: | methyltransferase activity (GO:0008168) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Methyltransf_29