The domain within your query sequence starts at position 57 and ends at position 221; the E-value for the Methyltransf_3 domain shown below is 1.1e-22.

QQHAKPGDPQSVLEAIDTYCSEKEWAMNVGDAKGQIMDAVIREYRPSLVLELGAYCGYSA
VRMARLLPPGARLLTMEINPDYAAITQQMLDFAGLQDKVSILIGASQDLIPQLKKKYDVD
TLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVIVPGTPD

Methyltransf_3

Methyltransf_3
PFAM accession number:PF01596
Interpro abstract (IPR002935): Members of this family are O-methyltransferases, including catechol O-methyltransferase [(PUBMED:16618795)], caffeoyl-CoA O-methyltransferase [(PUBMED:15734921)] and norbelladine 4'-O-methyltransferase [(PUBMED:25061748)]. The family includes also bacterial O-methyltransferases that may be involved in antibiotic production [(PUBMED:8936303)].
GO function:O-methyltransferase activity (GO:0008171)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Methyltransf_3