The domain within your query sequence starts at position 397 and ends at position 497; the E-value for the Methyltransf_4 domain shown below is 4.2e-7.

HAFFQVNTPAAEVLYTVIQEWAQLDGGSTVLDVCCGTGTIGLALAPKVKRVVGIELCQEA
VEDARMNALTNELSNVEFHCGRAEDLVPGLVSRLSSHQLVA

Methyltransf_4

Methyltransf_4
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Methyltransf_4