The domain within your query sequence starts at position 69 and ends at position 230; the E-value for the Methyltransf_5 domain shown below is 1.6e-47.
AKLHIPVMVDQVVHCLAPQKGQVFLDMTFGSGGHTRAILQKEPDVMVYALDRDPVAYAIA EQLSRLYPTQIQALLGQFSQAEALLMKAGVQPGTIDGILMDLGCSSMQLDAPERGFSLRK DGPLDMRMDGDRYPDTPTASDVVNALDQQALASILRAYGEEK
Methyltransf_5 |
---|
PFAM accession number: | PF01795 |
---|---|
Interpro abstract (IPR002903): | RsmH (previously known as MraW) is a methyltransferase responsible for one of the two methylations (N4-methylation) of C1402 in Escherichia coli 16S rRNA. The N4, 2'-O-dimethylcytidine (m4Cm) at position 1402 of the 16S rRNA directly interacts with the P-site codon of the mRNA. These conserved methyl-modifications may play a role in fine-tuning the shape and function of the P-site, thus increasing decoding fidelity [ (PUBMED:19965768) ]. |
GO function: | methyltransferase activity (GO:0008168) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Methyltransf_5