The domain within your query sequence starts at position 238 and ends at position 457; the E-value for the Methyltransf_8 domain shown below is 2.4e-107.
ALRARMTQRLDGARFRYLNEQLYSGPSSAARRLFQEDPEAFLLYHRGFQRQVKKWPLHPV DRIAKDLRQKPASLVVADFGCGDCRLASSVRNPVHCFDLASLDPRVTVCDMAQVPLEDES VDVAVFCLSLMGTNIRDFLEEANRVLKTGGLLKVAEVSSRFEDIRTFLGAVTKLGFKIIY KDLTNSHFFLFDFEKTGPPRVGPKAQLSGLKLQPCLYKRR
Methyltransf_8 |
---|
PFAM accession number: | PF05148 |
---|---|
Interpro abstract (IPR007823): | Ribosomal RNA processing protein 8 (Rrp8) is a nucleolar Rossman-fold like methyltransferase. In yeast, it is involved in pre-rRNA cleavage at site A2 [ (PUBMED:10864042) ] and is responsible for a base methylation of the 25S rRNA [ (PUBMED:23180764) ]. In humans it is also known as nucleomethylin (NML), and it is important for mediating the assembly of the energy-dependent nucleolar silencing complex (eNoSC), which regulates rRNA transcription in response to glucose deprivation [ (PUBMED:23897426) ]. NML represses rDNA transcription by promoting H3K9 methylation and establishing heterochromatin across the rDNA [ (PUBMED:18485871) ]. |
GO function: | methyltransferase activity (GO:0008168) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Methyltransf_8