The domain within your query sequence starts at position 56 and ends at position 350; the E-value for the Mg_trans_NIPA domain shown below is 1.6e-122.

YGFYIGVGLAFLSCFLIGTSVILKKKGLIRLVATGATRAVNGGYGYLKDPMWWAGMATMS
AGEVANFGAYAFAPATVVTPLGALSVLISAIFSSYCLGESLNLLGKLGCVICMAGSTVMV
IHAPKEEKVTTVAEMASKMKDTGFIVFAVLLVVSCLILIFIVAPRYGQRNILIYIIICSV
IGSFSVTAVKGLGVTIRNFFQGLPVVRHPLPYILSLILGLSIIIQVNFLNRALDIFNTSL
VFPIYYVFFTTVVVASSIVLFKEWYTMSAVDIVGTLSGFVTIILGVFMLHAFKDL

Mg_trans_NIPA

Mg_trans_NIPA
PFAM accession number:PF05653
Interpro abstract (IPR008521):

NIPA (nonimprinted in Prader-Willi/Angelman syndrome) is a family of integral membrane proteins which function as magnesium transporters [(PUBMED:17166836), (PUBMED:18667602)]. This entry also includes a group of uncharacterised bacterial proteins, such as Cgl0250 (UniProt:P42459) from Corynebacterium glutamicum.

GO process:magnesium ion transport (GO:0015693)
GO component:integral component of membrane (GO:0016021)
GO function:magnesium ion transmembrane transporter activity (GO:0015095)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Mg_trans_NIPA