The domain within your query sequence starts at position 915 and ends at position 1049; the E-value for the Microtub_bind domain shown below is 1.2e-44.
DLKLDIPTGMTPERKKYLYPTTLVRTEPREQLLDQLQKKQPPMMLNSSEASKETSQDMDE EREALEQCTEELVSPETTEHPSADCSSSRGLPFFQRKKPHGKDKENRGLNPVEKYKVEEA SDLSISKSRLPLHTS
Microtub_bind |
---|
PFAM accession number: | PF13931 |
---|---|
Interpro abstract (IPR025901): | This domain, found in kinesin and kinesin-like proteins, binds to microtubules [ (PUBMED:19291760) (PUBMED:17141610) ]. |
GO function: | microtubule binding (GO:0008017) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Microtub_bind