SMART: Pfam domain Milton

The domain within your query sequence starts at position 411 and ends at position 565; the E-value for the Milton domain shown below is 1.1e-41.

NDTRGRSVTFPVLLPIPGSNRSSVIMTAKPFESGVQPAEDKTLLSPGGSTEVPGNSQPTN
PPGSPEDSDLATALHRLSLRRQNYLSEKQFFAEEWERKIQILAEQEEEVSSCDAPTENLA
SVCTDQSETTDLGSASCLRGFMPEKLQIVKPLEGS

Milton

PFAM accession number:	PF12448
Interpro abstract (IPR022154):	This domain can be found at the C terminus of the eukaryotic trafficking kinesin-binding proteins, including TRAK1 and TRAK2. TRAK1 binds to both kinesin-1 and dynein/dynactin, is prominently localized in axons, and is needed for normal axon outgrowth, whereas TRAK2 predominantly interacts with dynein/dynactin, is more abundantly present in dendrites, and is required for dendritic development [ (PUBMED:23395375) ].

PFAM accession number:

PF12448

Interpro abstract (IPR022154):

This domain can be found at the C terminus of the eukaryotic trafficking kinesin-binding proteins, including TRAK1 and TRAK2. TRAK1 binds to both kinesin-1 and dynein/dynactin, is prominently localized in axons, and is needed for normal axon outgrowth, whereas TRAK2 predominantly interacts with dynein/dynactin, is more abundantly present in dendrites, and is required for dendritic development [ (PUBMED:23395375) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Milton