The domain within your query sequence starts at position 411 and ends at position 580; the E-value for the Milton domain shown below is 5e-72.

KQRSLTPSPMNIPGSNQSSAMNSLLSSCVSTPRSSFYGSDVSNVVLDNKTNSILLETEAA
DLGNEDHNKKPGTPGTPGSHDLETALRRLSLRRENYLSERRFFEEEQERKLRELAEKGEL
HSGSLTPTESIMSLGTHSRFSEFTGFSGMSFSSRSYLPEKLQIVKPLEGS

Milton

Milton
PFAM accession number:PF12448
Interpro abstract (IPR022154):

This domain is found in eukaryotic trafficking kinesin-binding proteins, which have been shown to be involved in the regulation of endosome-to-lysosome trafficking, including endocytic trafficking of EGF-EGFR complexes and GABA-A receptors in mammals [(PUBMED:18675823)]. They are also important for kinesin-mediated axonal transport of mitochondria to nerve terminals in Drosophila [(PUBMED:12495622)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Milton