The domain within your query sequence starts at position 10 and ends at position 79; the E-value for the Miro domain shown below is 3.7e-8.

KLIIVGALGVGKTSLLHQYVHKTFFEEYQTTLGASILSKIIILDDTTLKLQYQGTAENHL
IDSIKLSPGQ

Miro

Miro
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Miro