The domain within your query sequence starts at position 8 and ends at position 156; the E-value for the Mis12 domain shown below is 2.5e-47.

YEAQFFGFTPQTCLLRIYVAFQDHLFEVMQAVEQVILKKLEDIPNCEITPVQTRKCTEKF
LCFMKGRFDNLFGKMEQLILQSILCIPPNILLPEDKCQETNPFSEEKLELLQQEIKELQE
KYKVELCTEQALLAELEEQKTVKAKLRET

Mis12

 Mis12
PFAM accession number:PF05859
Interpro abstract (IPR008685):

Kinetochores are the chromosomal sites for spindle interaction and play a vital role for chromosome segregation. Fission Saccharomyces cerevisiae kinetochore protein Mis12, is required for correct spindle morphogenesis, determining metaphase spindle length [ (PUBMED:10398680) ]. Thirty-five to sixty percent extension of metaphase spindle length takes place in Mis12 mutants [ (PUBMED:10398680) ]. It has been shown that Mis12 might genetically interact with Mal2p [ (PUBMED:12242294) ].

GO process:mitotic cell cycle (GO:0000278)
GO component:nucleus (GO:0005634), chromosome, centromeric region (GO:0000775)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Mis12