The domain within your query sequence starts at position 6 and ends at position 120; the E-value for the Misat_Tub_SegII domain shown below is 2.1e-36.

REVLTLQLGHFAGFVGAHWWNQQDAALGRMAEDEESPGELCPDVLYRTGRTLHGQETYTP
RLILMDLKGSLNTLKEEGNLYRDRQLEAAVAWQGKLSTHRDDAQPKNPNLQGLLS

Misat_Tub_SegII

Misat_Tub_SegII
PFAM accession number:PF10644
Interpro abstract (IPR019605):

The misato protein contains three distinct, conserved domains, segments I, II and III and is involved in the regulation of mitochondrial distribution and morphology [(PUBMED:17349998)]. This entry represents misato segment II.

Segments I and III are common to tubulins (IPR003008), but segment II aligns with myosin heavy chain sequences from Drosophila melanogaster (Fruit fly, P05661), rabbit (P04460), and human.

Segment II of misato is a major contributor to its greater length compared with the various tubulins. The most significant sequence similarities to this 54-amino acid region are from a motif found in the heavy chains of myosins from different organisms. A comparison of segment II with the vertebrate myosin heavy chains reveals that it shares homology with a myosin peptide in the hinge region linking the S2 and LMM domains. Segment II also contains heptad repeats which are characteristic of the myosin tail alpha-helical coiled-coils [(PUBMED:9144213)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Misat_Tub_SegII