The domain within your query sequence starts at position 1 and ends at position 91; the E-value for the Mito_carr domain shown below is 1.5e-21.

MALDFLAGCAGGVAGVIVGHPFDIVKVRLQVQSTEKPQYRGTLHCFQSIIKQESVLGLYK
GLGSPLMGLTFINALVFGVQGNTLRALGQDS

Mito_carr

Mito_carr
PFAM accession number:PF00153
Interpro abstract (IPR018108):

A variety of substrate carrier proteins that are involved in energy transfer are found in the inner mitochondrial membrane or integral to the membrane of other eukaryotic organelles such as the peroxisome [ (PUBMED:2158156) (PUBMED:8140286) (PUBMED:8487299) (PUBMED:8206158) (PUBMED:8291088) ]. Such proteins include: ADP, ATP carrier protein (ADP/ATP translocase); 2-oxoglutarate/malate carrier protein; phosphate carrier protein; tricarboxylate transport protein (or citrate transport protein); Graves disease carrier protein; yeast mitochondrial proteins MRS3 and MRS4; yeast mitochondrial FAD carrier protein; and many others. Structurally, these proteins can consist of up to three tandem repeats of a domain of approximately 100 residues, each domain containing two transmembrane regions.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Mito_carr