The domain within your query sequence starts at position 20 and ends at position 168; the E-value for the Mito_fiss_reg domain shown below is 2.2e-63.
MQSVLWSGKPYGSSRSIVRKIGTNLSLIQCPRVQFQLTSHATEWSPAHSGEDAVASFADV GLVATEEGECSIRLRAEVSSKPPHEDDPPCFEKPPSRHTSFPSLSQDKPSPERTLASEEA LQKISALENELAALRAQIAKIVTLQEQQS
Mito_fiss_reg |
---|
PFAM accession number: | PF05308 |
---|---|
Interpro abstract (IPR007972): | Mitochondrial fission regulator 1 has been described in mammals, where it induces mitochondrial fission [ (PUBMED:15389597) (PUBMED:20568109) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Mito_fiss_reg