The domain within your query sequence starts at position 20 and ends at position 55; the E-value for the Mito_fiss_reg domain shown below is 1.1e-20.

MQSVLWSGKPYGSSRSIVRKIGTNLSLIQCPRVQFQ

Mito_fiss_reg

Mito_fiss_reg
PFAM accession number:PF05308
Interpro abstract (IPR007972):

Mitochondrial fission regulator 1 has been described in mammals, where it induces mitochondrial fission [ (PUBMED:15389597) (PUBMED:20568109) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Mito_fiss_reg