The domain within your query sequence starts at position 13 and ends at position 131; the E-value for the Mitoc_L55 domain shown below is 4.4e-55.
VRSLLRHCGVRAALPTPRHLHTSPWRADCSRASLTRLRRQAYARLYPVLLVKQDGSTIHI RYREPRRMLAMPLDLDALSPEERRARFRKREAQLQQKREEEPEVVDSFDTERYKQFWTK
Mitoc_L55 |
![]() |
---|
PFAM accession number: | PF09776 |
---|---|
Interpro abstract (IPR018615): | Members of this family are involved in mitochondrial biogenesis and G2/M phase cell cycle progression. They form a component of the mitochondrial ribosome large subunit (39S) which comprises a 16S rRNA and about 50 distinct proteins [ (PUBMED:15894314) ]. |
GO component: | mitochondrial large ribosomal subunit (GO:0005762) |
GO function: | structural constituent of ribosome (GO:0003735) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Mitoc_L55