The domain within your query sequence starts at position 6 and ends at position 124; the E-value for the Mitoc_L55 domain shown below is 9.7e-56.

LLSLLRHCGVRAALPTPRHLHTSPWRADCSRASLTRLRRQAYARLYPVLLVKQDGSTIHI
RYREPRRMLAMPLDLDALSPEERRARFRKREAQLQQKREEEPEVVDSFDTERYKQFWTK

Mitoc_L55

Mitoc_L55
PFAM accession number:PF09776
Interpro abstract (IPR018615):

Members of this family are involved in mitochondrial biogenesis and G2/M phase cell cycle progression. They form a component of the mitochondrial ribosome large subunit (39S) which comprises a 16S rRNA and about 50 distinct proteins [ (PUBMED:15894314) ].

GO component:mitochondrial large ribosomal subunit (GO:0005762)
GO function:structural constituent of ribosome (GO:0003735)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Mitoc_L55