The domain within your query sequence starts at position 1 and ends at position 93; the E-value for the Mlf1IP domain shown below is 9.6e-18.

MSRMLSGGFGYSPFLSITDGNMPATRPASRRMQAGAVSPFGMLGMSGGFMDMFGMMNDMI
GNMEHMAAGGNCQTFSSSTVISYSNTGDGAPK

Mlf1IP

Mlf1IP
PFAM accession number:PF10248
Interpro abstract (IPR019376): Myeloid leukemia factor is involved in lineage commitment of primary hemopoietic progenitors by restricting erythroid formation and enhancing myeloid formation [(PUBMED:15861129)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Mlf1IP