The domain within your query sequence starts at position 26 and ends at position 69; the E-value for the Mlf1IP domain shown below is 5.5e-7.
MRNMMRSFSEPLGRDLLSISDGRGRTHNRRERDDGEDSLTKTYL
Mlf1IP |
---|
PFAM accession number: | PF10248 |
---|---|
Interpro abstract (IPR019376): | Myeloid leukemia factor is involved in lineage commitment of primary hemopoietic progenitors by restricting erythroid formation and enhancing myeloid formation [ (PUBMED:15861129) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Mlf1IP