The domain within your query sequence starts at position 504 and ends at position 760; the E-value for the Mlh1_C domain shown below is 8.3e-100.

IINLTSVLSLQEEISERCHETLREMLRNHSFVGCVNPQWALAQHQTKLYLLNTTKLSEEL
FYQILIYDFANFGVLRLSEPAPLFDLAMLALDSPESGWTEDDGPKEGLAEYIVEFLKKKA
EMLADYFSVEIDEEGNLIGLPLLIDSYVPPLEGLPIFILRLATEVNWDEEKECFESLSKE
CAMFYSIRKQYILEESTLSGQQSDMPGSTSKPWKWTVEHIIYKAFRSHLLPPKHFTEDGN
VLQLANLPDLYKVFERC

Mlh1_C

Mlh1_C
PFAM accession number:PF16413
Interpro abstract (IPR032189):

This is the C-terminal domain of DNA mismatch repair protein Mlh1, which belongs to the MutL family. This domain forms part of the endonuclease active site [(PUBMED:23435383)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Mlh1_C