The domain within your query sequence starts at position 16 and ends at position 202; the E-value for the Mnd1 domain shown below is 1.7e-76.

MMEIFFETKDVFQLKDLEKLAPKEKGITAMSVKEVLQSLVDDGMVDCERIGTSNYYWAFP
SKALHARKRKLEALNSQLSEGSQKHADLQKSIEKARVGRQETEERAMLAKELSSFRDQRQ
QLKAEVEKYRECDPQVVEEIREANKVAKEAANRWTDNIFAIKSWAKRKFGFEESKIDKNF
GIPEDFD

Mnd1

Mnd1
PFAM accession number:PF03962
Interpro abstract (IPR005647): This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast). The mnd1 protein forms a complex with hop2 to promote homologous chromosome pairing and meiotic double-strand break repair [(PUBMED:11940665)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Mnd1