The domain within your query sequence starts at position 156 and ends at position 490; the E-value for the MnmE_helical domain shown below is 2e-48.

LTEVEGLADLIRAETEAQRRQALRQLDGELSQLCQGWAKTLTKALAYVEAYIDFGEDDNL
EEGVLEQADREVRALEVALGSHLRDARRGQRLLSGANVVVTGPPNAGKSSLVNLLSQKPV
SIVSPEPGTTRDVLETPVDLAGFPVLLSDTAGLREGVGAVEQEGVRRARHRLEQADIILG
VLDASDLASSSSCSFLDTVVTPLLAQSQDSGGQRLLLLLNKSDLLSANAPACDIALPPHL
LLSCHTGAGMDSLLQALKTELAAVCGDPSTGPPLLTRVRHQYHLQGCLDALGHYQLATDL
ALAAEALRQARRQLNHLTGGGGTEEILDLIFQDFC

MnmE_helical

MnmE_helical
PFAM accession number:PF12631
Interpro abstract (IPR025867):

The tRNA modification GTPase MnmE consists of three domains. An N-terminal domain, a helical domain and a GTPase domain which is nested within the helical domain. This entry represents the helical domain [(PUBMED:12730230), (PUBMED:19806182)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MnmE_helical