The domain within your query sequence starts at position 1 and ends at position 104; the E-value for the Mo25 domain shown below is 6.6e-31.

MPFPFGKSHKSPADIVKNLKESMAVLEKQDISDKKAEKATEEVSKNLVAMKEILYGTNEK
EPQTEAVAQLAQELYNSGLLGTLVADLQLIDFEGKKDVAQIFNN

Mo25

Mo25
PFAM accession number:PF08569
Interpro abstract (IPR013878):

Mo25-like proteins are involved in both polarised growth and cytokinesis. In fission yeast Mo25 is localised alternately to the spindle pole body and to the site of cell division in a cell cycle dependent manner [ (PUBMED:16325501) (PUBMED:16096637) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Mo25