The domain within your query sequence starts at position 1 and ends at position 104; the E-value for the Mo25 domain shown below is 6.6e-31.
MPFPFGKSHKSPADIVKNLKESMAVLEKQDISDKKAEKATEEVSKNLVAMKEILYGTNEK EPQTEAVAQLAQELYNSGLLGTLVADLQLIDFEGKKDVAQIFNN
Mo25 |
---|
PFAM accession number: | PF08569 |
---|---|
Interpro abstract (IPR013878): | Mo25-like proteins are involved in both polarised growth and cytokinesis. In fission yeast Mo25 is localised alternately to the spindle pole body and to the site of cell division in a cell cycle dependent manner [ (PUBMED:16325501) (PUBMED:16096637) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Mo25