SMART: Pfam domain MoaC

The domain within your query sequence starts at position 493 and ends at position 628; the E-value for the MoaC domain shown below is 6.1e-49.

MVDVGGKPETERVAVASAMVLLGPVAFKLVQQNQLKKGDALVVAQLAGVQAAKLTSQLIP
LCHHVALSHVQVHLELDSTRHAVLIQASCRARGPTGVEMEALTSAAMAALTVYDMCKAVS
RDIVVTEVKLISKTGG

MoaC

PFAM accession number:	PF01967
Interpro abstract (IPR002820):	The majority of molybdenum-containing enzymes utilise a molybdenum cofactor (MoCF or Moco) consisting of a Mo atom coordinated via a cis-dithiolene moiety to molybdopterin (MPT). MoCF is ubiquitous in nature, and the pathway for MoCF biosynthesis is conserved in all three domains of life. MoCF-containing enzymes function as oxidoreductases in carbon, nitrogen, and sulphur metabolism [ (PUBMED:16784786) (PUBMED:12114025) ]. In Escherichia coli, biosynthesis of MoCF is a three stage process. It begins with the MoaA and MoaC conversion of GTP to the meta-stable pterin intermediate precursor Z. The second stage involves MPT synthase (MoaD and MoaE), which converts precursor Z to MPT; MoeB is involved in the recycling of MPT synthase. The final step in MoCF synthesis is the attachment of mononuclear Mo to MPT, a process that requires MoeA and which is enhanced by MogA in an Mg2 ATP-dependent manner [ (PUBMED:17198377) ]. MoCF is the active co-factor in eukaryotic and some prokaryotic molybdo-enzymes, but the majority of bacterial enzymes requiring MoCF, need a modification of MTP for it to be active; MobA is involved in the attachment of a nucleotide monophosphate to MPT resulting in the MGD co-factor, the active co-factor for most prokaryotic molybdo-enzymes. Bacterial two-hybrid studies have revealed the close interactions between MoeA, MogA, and MobA in the synthesis of MoCF [ (PUBMED:12372836) ]. Moreover the close functional association of MoeA and MogA in the synthesis of MoCF is supported by fact that the known eukaryotic homologues to MoeA and MogA exist as fusion proteins: CNX1 ( Q39054 ) of Arabidopsis thaliana (Mouse-ear cress), mammalian Gephryin (e.g. Q9NQX3 ) and Drosophila melanogaster (Fruit fly) Cinnamon ( P39205 ) [ (PUBMED:8528286) ]. This entry contains the molybdenum cofactor biosynthesis protein MoaC, also known as cyclic pyranopterin monophosphate synthase.
GO process:	Mo-molybdopterin cofactor biosynthetic process (GO:0006777)

PFAM accession number:

PF01967

Interpro abstract (IPR002820):

The majority of molybdenum-containing enzymes utilise a molybdenum cofactor (MoCF or Moco) consisting of a Mo atom coordinated via a cis-dithiolene moiety to molybdopterin (MPT). MoCF is ubiquitous in nature, and the pathway for MoCF biosynthesis is conserved in all three domains of life. MoCF-containing enzymes function as oxidoreductases in carbon, nitrogen, and sulphur metabolism [ (PUBMED:16784786) (PUBMED:12114025) ].

In Escherichia coli, biosynthesis of MoCF is a three stage process. It begins with the MoaA and MoaC conversion of GTP to the meta-stable pterin intermediate precursor Z. The second stage involves MPT synthase (MoaD and MoaE), which converts precursor Z to MPT; MoeB is involved in the recycling of MPT synthase. The final step in MoCF synthesis is the attachment of mononuclear Mo to MPT, a process that requires MoeA and which is enhanced by MogA in an Mg2 ATP-dependent manner [ (PUBMED:17198377) ]. MoCF is the active co-factor in eukaryotic and some prokaryotic molybdo-enzymes, but the majority of bacterial enzymes requiring MoCF, need a modification of MTP for it to be active; MobA is involved in the attachment of a nucleotide monophosphate to MPT resulting in the MGD co-factor, the active co-factor for most prokaryotic molybdo-enzymes. Bacterial two-hybrid studies have revealed the close interactions between MoeA, MogA, and MobA in the synthesis of MoCF [ (PUBMED:12372836) ]. Moreover the close functional association of MoeA and MogA in the synthesis of MoCF is supported by fact that the known eukaryotic homologues to MoeA and MogA exist as fusion proteins: CNX1 ( Q39054 ) of Arabidopsis thaliana (Mouse-ear cress), mammalian Gephryin (e.g. Q9NQX3 ) and Drosophila melanogaster (Fruit fly) Cinnamon ( P39205 ) [ (PUBMED:8528286) ].

This entry contains the molybdenum cofactor biosynthesis protein MoaC, also known as cyclic pyranopterin monophosphate synthase.

GO process:

Mo-molybdopterin cofactor biosynthetic process (GO:0006777)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MoaC