The domain within your query sequence starts at position 49 and ends at position 161; the E-value for the MoaE domain shown below is 7.1e-43.
FTAEKLSVGEVSQLVVSPLCGAVSLFVGTTRNNFEGKKVISLEYEAYVPMAENEIRKICN DIRQKWPVRHIAVFHRLGLVPVSEASTVIAVSSAHRAASLEAVSYAIDSLKAK
MoaE |
---|
PFAM accession number: | PF02391 |
---|---|
Interpro abstract (IPR003448): | Members of the MoaE family are involved in biosynthesis of the molybdenum cofactor (Moco), an essential cofactor for a diverse group of redox enzymes. Moco biosynthesis is an evolutionarily conserved pathway present in eubacteria, archaea and eukaryotes. Moco contains a tricyclic pyranopterin, termed molybdopterin (MPT), which carries the cis-dithiolene group responsible for molybdenum ligation. This dithiolene group is generated by MPT synthase in the second major step in Moco biosynthesis. MPT synthase is a heterotetramer consisting of two large (MoaE) and two small (MoaD) subunits [ (PUBMED:8514782) (PUBMED:12504674) (PUBMED:11913130) (PUBMED:10746556) (PUBMED:15709772) (PUBMED:12571227) (PUBMED:12571226) ]. |
GO process: | Mo-molybdopterin cofactor biosynthetic process (GO:0006777) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MoaE