The domain within your query sequence starts at position 21 and ends at position 165; the E-value for the Mod_r domain shown below is 8.1e-35.
ILSTGQLRDLLQDEPKLDRIVRLSRKFQGLQLERDACLASNYALAKENLALRPRLEMGRT ALAIKYQELREVAENCADKLQRLEKSMHRWSPQCALGWLQAELEEAEQEAEVQMEQLLLG EQSLEAFLPAFQRGRALAHLRRTQA
Mod_r |
---|
PFAM accession number: | PF07200 |
---|---|
Interpro abstract (IPR009851): | This entry represents a conserved region approximately 150 residues long within a number of eukaryotic proteins that show homology with Drosophila melanogaster Modifier of rudimentary (Mod(r)) proteins. The N-terminal half of Mod(r) proteins is acidic, whereas the C-terminal half is basic [ (PUBMED:7651329) ], and both of these regions are represented in this family. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Mod_r