The domain within your query sequence starts at position 146 and ends at position 461; the E-value for the Mon1 domain shown below is 1.1e-138.

EDATEAWRLHQKHVFVLSEAGKPVYSRYGSEEALSSTMGVMVALVSFLEADKNAIRSIHA
DGYKVVFVRRSPLVLVAVARTRQSAQELAQELLYIYYQILSLLTGAQLSHIFQQKQNYDL
RRLLSGSERITDNLLQLMARDPSFLMGAARCLPLAAAVRDTVSASLQQARARSLVFSILL
AHNQLVALVRRKDQFLHPIDLHLLFNLISSSSSFREGEAWTPVCLPKFSAAGFFHAHISY
LEPDTDLCLLLISTDREDFFAVSDCRRRFQERLRKRGTHLALREALRTPYYSVAQVGIPD
LRHFLYKSKSSGLFTR

Mon1

Mon1
PFAM accession number:PF03164
Interpro abstract (IPR004353):

Members of this family have been called SAND proteins [(PUBMED:15647795)] although these proteins do not contain a SAND domain. In Saccharomyces cerevisiae, Mon1 is part of the Mon1-Ccz1 complex that acts as the guanine nucleotide exchange factor (GEF) of the yeast Rab7 GTPase Ypt7 [(PUBMED:24413168), (PUBMED:24623720)]. The Mon1/Ccz1 complex is conserved in eukaryotic evolution and members of this family (previously known as DUF254) are distant homologues to domains of known structure that assemble into cargo vesicle adapter (AP) complexes [(PUBMED:10025966), (PUBMED:17075139)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Mon1