The domain within your query sequence starts at position 327 and ends at position 432; the E-value for the Motile_Sperm domain shown below is 1.1e-23.
LLHISPAEELYFGSIESGEKKTLIVLTNVTKNIVAFKVRTTAPEKYRVKPSNSSCDPGAS IDIIVSPHGGLTVSAQDRFLIMAAEMEQSSGTGPAELSQFWKEVPR
Motile_Sperm |
---|
PFAM accession number: | PF00635 |
---|---|
Interpro abstract (IPR000535): | Nematode sperm are unusual amoeboid cells in which motility is not based on actin, but instead on the major sperm protein (MSP). MSP is a dimeric molecule that polymerises to form non-polar filaments constructed from two helical subfilaments that wind round one another. The filaments then assemble into larger macromolecular assemblies called fibre complexes. MSP is a small (~14kDa) basic protein typically encoded by a multigene family of up to 28 members [ (PUBMED:8913307) (PUBMED:12051923) (PUBMED:9878374) (PUBMED:9641981) ]. An about 120-amino acid domain similar to MSP has been found in other proteins, including:
The MSP polypeptide chain has an immunoglobulin-like fold based on a seven- stranded beta sandwich measuring approximately 15 A x 20 A x 45 A and having opposing three-stranded and four-stranded beta sheets [ (PUBMED:8913307) ]. This entry represents the MSP domain. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Motile_Sperm