The domain within your query sequence starts at position 20 and ends at position 654; the E-value for the Mpp10 domain shown below is 6.9e-217.

KATNRPECFLTIQNGLASNFTSLTKVLYDFNKVLENGRISGSPLQKLEINSFDDEQIWQQ
LELQNEPVLQYFQNAVSETVEDEDISLLPECEDEECEEDASEVEADNQENLETDLDEEQL
SDEGGDVPKGRDRAKSSRKSDPRKSPVFSDEDSDLDFDIGKLEQQTKMQIKPPGKPREKS
VVDDKFFKLSEMESFLEKVEKEEEKRPDGEEEDEEDIDLFEDIDSDESEGGLFGRQKIKS
NKSSRNLKYKDFFDPVESDEDITGVDEELGPDEEKEEEEGFAEEADESISDTDEDNDLEE
DENSDQHKGSLKRVTFALPDDEAEDTSPLAVKQESDEVKSSFEKRQEKMNEKIASLEKEL
LDKKPWQLQGEVTAQKRPENSLLEETLHFDHAVRMAPVITEETTLHLEDIIKQRIRDQAW
DDVERKEKPKEDAYEYKKRLTLDHEKSKLSLAEIYEQEYLKLNQQKTEEEDNPEHVEIQK
MMDSLFLKLDALSNFHFIPKPPVPEIKVVSNLPAITMEEVAPVSVSDAALLAPEEIKEKN
KAGDLKTAAEKTATDKKRERRKKKYQKRLKIKEKEKRKKLLEKNNPDQSKSSRAAASEKL
KQLTKTGKVSLLKDERKDKPLKSSQAFFSKLQDQV

Mpp10

Mpp10
PFAM accession number:PF04006
Interpro abstract (IPR012173):

Mpp10 (M phase phosphoprotein 10) is a component of the 60-80S U3 small nucleolar ribonucleoprotein (U3 snoRNP) required for three cleavage events that generate the mature 18S rRNA from the pre-rRNA [(PUBMED:9391061), (PUBMED:9450966)].

GO process:rRNA processing (GO:0006364)
GO component:small nucleolar ribonucleoprotein complex (GO:0005732), nucleus (GO:0005634), Mpp10 complex (GO:0034457)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Mpp10