The domain within your query sequence starts at position 16 and ends at position 322; the E-value for the Mtc domain shown below is 8.3e-154.

WDQSTFIGRASHFFTVTDPRNILLTNEQLENARKVVHDYRQGIVPAGLTENELWRAKYAY
DSAFHPDTGEKMTLIGRMSAQVPMNMTITGCMMTFYRTTPAVLFWQWINQSFNAVVNYTN
RSGDAPLTVNELGTAYVSATTGAVATALGLNALTKRVSPLIGRFVPFAAVAAANCINIPL
MRQRELKVGIPVTDENGTRLGESTNAAKQAITQVVISRILMAAPGMAIPPFIMNTLEKKA
FLKRFPWMSAPIQVTLVGFCLVFATPLCCALFPQKSSMSVTSLEDELQASIQRTHPEIRR
VYFNKGL

Mtc

Mtc
PFAM accession number:PF03820
Interpro abstract (IPR004686): The MTC family consists of a limited number of homologues, all from eukaryotes. One member of the family has been functionally characterised as a tricarboxylate carrier from rat liver mitochondria. The rat liver mitochondrial tricarboxylate carrier has been reported to transport citrate, cis-aconitate, threo-D-isocitrate, D- and L-tartrate, malate, succinate and phosphoenolpyruvate. It presumably functions by a proton symport mechanism. The rest of the characterised proteins appear to be sideroflexins involved in iron transport.
GO process:transmembrane transport (GO:0055085), ion transport (GO:0006811)
GO component:membrane (GO:0016020)
GO function:ion transmembrane transporter activity (GO:0015075)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Mtc