The domain within your query sequence starts at position 523 and ends at position 557; the E-value for the Mtf2_C domain shown below is 7.7e-11.

GGVSYLSRGDPVRVLARRVRPDGSVQYLVEWGGGG

Mtf2_C

Mtf2_C
PFAM accession number:PF14061
Interpro abstract (IPR025894):

Mammalian Polycomb-like gene MTF2/PCL2 forms a complex with Polycomb repressive complex-2 (PRC2) and collaborates with PRC1 to achieve repression of Hox gene expression [(PUBMED:21059868)]. The human MTF2 gene is expressed in three splicing variants, each of them contains the short C-terminal domain defined here.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Mtf2_C