The domain within your query sequence starts at position 221 and ends at position 307; the E-value for the Mtp domain shown below is 1e-19.

DFPYKDDLLALDSSCLLFIVLVFFVVFIIFKAYLINCVWNCYKYINNRNVPEIAVYPAFE
TPPQYVLPTYEMAVKIPEKEPPPPYLP

Mtp

Mtp
PFAM accession number:PF03821
Interpro abstract (IPR004687):

The lysosome associated protein transmembrane (LAPTM) family is comprised of three members: LAPTM5, LAPTM4a and LAPTM4b; they are lysosome-associated transmembrane proteins, found in mammals, insects and nematodes.

GO component:integral component of membrane (GO:0016021)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Mtp