The domain within your query sequence starts at position 28 and ends at position 107; the E-value for the Mtp domain shown below is 1.3e-28.
HIVMSVLLFIEHVVEVARGKVSCRFFKMPYLRMALPQSLPCLAADLLSSFLLIGVLFIIS ISLLFGVVKNREKYLIPFLS
Mtp |
---|
PFAM accession number: | PF03821 |
---|---|
Interpro abstract (IPR004687): | The lysosome associated protein transmembrane (LAPTM) family is comprised of three members: LAPTM5, LAPTM4a and LAPTM4b; they are lysosome-associated transmembrane proteins, found in mammals, insects and nematodes. |
GO component: | integral component of membrane (GO:0016021) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Mtp