The domain within your query sequence starts at position 3778 and ends at position 3867; the E-value for the Mucin2_WxxW domain shown below is 3.2e-24.

KWTEWFDADYPNPGPRGGDFEVYAVFREVGYIFCDQPKDIECRSEKEPDRPLETLEQVVQ
CDVRFGLICKNINQSGPLQYCDNYHVRLLC

Mucin2_WxxW

Mucin2_WxxW
PFAM accession number:PF13330
Interpro abstract (IPR025155):

This domain of unknown function carries a highly conserved WxxW sequence motif and also has at least six well conserved cysteine residues. It is found in variable numbers ranging from a single copy up to 32 consecutive copies, as in C3Y5K5, from Branchiostoma floridae.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Mucin2_WxxW