The domain within your query sequence starts at position 129 and ends at position 193; the E-value for the Myb_DNA-bind_2 domain shown below is 3.9e-35.

GRIAYTDAEDVAILTYVKENARSPSSVTGNALWKAMEKSSLTQHSWQSLKDRYLKHLRGQ
EHKYL

Myb_DNA-bind_2

Myb_DNA-bind_2
PFAM accession number:PF08914
Interpro abstract (IPR015010):

Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif. The function is unclear but it may either interact with DNA via an adaptor protein or it may be only involved in protein-protein interactions [ (PUBMED:11545594) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Myb_DNA-bind_2