The domain within your query sequence starts at position 1 and ends at position 161; the E-value for the Myc_N domain shown below is 6.7e-29.

MDFDSYQHYFYDYDCGEDFYRSTAPSEDIWKKFELVPSPPTSPPWGSGPGAVDPASGINP
GEPWPGGGAGDEAESRGHSKAWGRNYASIIRRDCMWSGFSARERLERVVSDRLAPGAPRG
NPPKAPATPDGTPSLEASNPAPATQCQLGEPKTQACSGSES

Myc_N

Myc_N
PFAM accession number:PF01056
Interpro abstract (IPR012682): The class III basic helix-turn-helix (bHLH) transcription factors have proliferative and apoptotic roles and are characterised by the presence of a leucine zipper adjacent to the bHLH domain. The myc oncogene gene was first discovered in small-cell lung cancer cell lines where it is found to be deregulated [(PUBMED:2827002)]. Although the biochemical function of the gene product is unknown, as a nuclear protein with a short half-life it may play a direct or indirect role in controlling gene expression [(PUBMED:3018999)]. Myc forms a heterodimer with Max, and this complex regulates cell growth through direct activation of genes involved in cell replication [(PUBMED:9175477)].

This entry represents the N-terminal domain found adjacent to the basic helix-loop-helix (bHLH) region (IPR011598).

GO process:regulation of transcription, DNA-templated (GO:0006355)
GO function:DNA binding transcription factor activity (GO:0003700)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Myc_N