The domain within your query sequence starts at position 1 and ends at position 187; the E-value for the Myc_target_1 domain shown below is 2.5e-80.
MANNTTSLGSPWPENFWEDLIMSFTVSVAIGLAIGGFLWALFVFLSRRRRASAPISQWSP TRRPRSSYNHGLNRTGFYRHSGYERRSNLSLASLTFQRQASMELVNSFPRKSSFRASTFH PFLQCPPLPVETESQLMTLSASTTPSTLSTAHSPSRPDFRWSSNSLRMGLSTPPPPAYES IIKAFPD
Myc_target_1 |
![]() |
---|
PFAM accession number: | PF15179 |
---|---|
Interpro abstract (IPR029180): | Myc target protein 1 (MYCT1) is regulated by the c-Myc oncoprotein; its promoter is a direct c-Myc target. Furthermore, MYCT1 regulates the expression of several other c-Myc target genes [ (PUBMED:11909865) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Myc_target_1