SMART: Pfam domain Myelin-PO

The domain within your query sequence starts at position 184 and ends at position 248; the E-value for the Myelin-PO_C domain shown below is 4.3e-38.

LRRQAALQRRLSAMEKGRFHKSSKDSSKRGRQTPVLYAMLDHSRSTKAASEKKSKGLGES
RKDKK

Myelin-PO_C

PFAM accession number:	PF10570
Interpro abstract (IPR019566):	The myelin sheath is a multi-layered membrane, unique to the nervous system, that functions as an insulator to greatly increase the velocity of axonal impulse conduction. The P0 glycoprotein, absent in the central nervous system [ (PUBMED:2435734) ], is a major component of the myelin sheath in peripheral nerves. It comprises a large extracellular N-terminal domain, a single transmembrane (TM) region, and a smaller positively charged intracellular domain. It is postulated that P0 is a structural element in the formation and stabilisation of peripheral nerve myelin [ (PUBMED:2578885) ], holding its characteristic coil structure together by the interaction of its positively-charged domain with acidic lipids in the cytoplasmic face of the opposed bilayer, and by interaction between hydrophobic globular `heads' of adjacent extracellular domains [ (PUBMED:2435734) ]. This entry is the extracellular domain found at the C-terminal end of myelin-PO.

PFAM accession number:

PF10570

Interpro abstract (IPR019566):

The myelin sheath is a multi-layered membrane, unique to the nervous system, that functions as an insulator to greatly increase the velocity of axonal impulse conduction. The P0 glycoprotein, absent in the central nervous system [ (PUBMED:2435734) ], is a major component of the myelin sheath in peripheral nerves. It comprises a large extracellular N-terminal domain, a single transmembrane (TM) region, and a smaller positively charged intracellular domain. It is postulated that P0 is a structural element in the formation and stabilisation of peripheral nerve myelin [ (PUBMED:2578885) ], holding its characteristic coil structure together by the interaction of its positively-charged domain with acidic lipids in the cytoplasmic face of the opposed bilayer, and by interaction between hydrophobic globular `heads' of adjacent extracellular domains [ (PUBMED:2435734) ].

This entry is the extracellular domain found at the C-terminal end of myelin-PO.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Myelin-PO_C