The domain within your query sequence starts at position 1167 and ends at position 1257; the E-value for the Myosin-VI_CBD domain shown below is 1.4e-46.

QRFFRIPFIRPADQYKDPQNKKKGWWYAHFDGPWIARQMELHPDKPPILLVAGKDDMEMC
ELNLEETGLTRKRGAEILPRQFEEIWERCGG

Myosin-VI_CBD

Myosin-VI_CBD
PFAM accession number:PF16521
Interpro abstract (IPR032412):

This entry represents the C-terminal cargo binding domain (CBD) of myosin-VI. Several adaptor proteins have been reported to interact specifically with the CBD, thus defining the specific subcellular functions of myosin VI. The crystal structure determination of the myosin VI CBD/Dab2 (an endocytic adaptor protein Disabled-2 that is a cargo) complex shows that the CBD forms a cargo-induced dimer, suggesting that the motor undergoes monomer-to-dimer conversion that is dependent upon cargo binding. In the absence of cargo, myosin VI exists as a stable monomer. This cargo binding-mediated monomer-to-dimer conversion mechanism adopted by myosin VI may be shared by other unconventional myosins, such as myosin VII and myosin X [(PUBMED:19665975)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Myosin-VI_CBD