The domain within your query sequence starts at position 464 and ends at position 618; the E-value for the NACHT domain shown below is 7.6e-37.

SVMCVEGEAGSGKTTFLKRIAFLWASGCCPLLYRFQLVFYLSLSSITPDQGLANIICTQL
LGAGGCISEVCLSSSIQQLQHQVLFLLDDYSGLASLPQALHTLITKNYLFRTCLLIAVHT
NRVRDIRPYLGTSLEIQEFPFYNTVFVLRKFFSHD

NACHT

NACHT
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NACHT