The domain within your query sequence starts at position 180 and ends at position 348; the E-value for the NACHT domain shown below is 6.9e-30.

HAIVLHGPPGSGKTTMAKQLMLEWSESKQAQIFSCAFYISCREVNNTKPCTFAHLLSMDN
PSWRDCVIRDLILGKEFLFVVDGFDELTFPAGALIRDLCGDWNTVKPVEVLLGSLLKRKM
APHATLLVTTRTQSLHQIFVMMDQPLLVETLGFLEQEKQEYFQKYFEDE

NACHT

NACHT
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NACHT