The domain within your query sequence starts at position 34 and ends at position 105; the E-value for the NADH_B2 domain shown below is 6.9e-42.
AGGGVHIQPRYREFPQLTRSQVIQGEFLSSLMWFWILWRFWHDSDAVLGHFSYPDPSQWT DEELGIPPDDED
NADH_B2 |
---|
PFAM accession number: | PF14813 |
---|---|
Interpro abstract (IPR026627): | NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2 is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone [ (PUBMED:12611891) (PUBMED:9878551) ]. |
GO component: | mitochondrial respiratory chain complex I (GO:0005747), mitochondrial inner membrane (GO:0005743) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NADH_B2