The domain within your query sequence starts at position 28 and ends at position 76; the E-value for the NADH_dh_m_C1 domain shown below is 3.7e-32.

KFYVREPVNAKPNWLAVGLSVGASVFMWIYLIQTHNEDVLEYKRRNGLE

NADH_dh_m_C1

NADH_dh_m_C1
PFAM accession number:PF15088
Interpro abstract (IPR026192):

Subunit C1 is a accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. NADH dehydrogenase complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone [ (PUBMED:9425316) ].

GO component:mitochondrial respiratory chain complex I (GO:0005747), mitochondrion (GO:0005739)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NADH_dh_m_C1