The domain within your query sequence starts at position 658 and ends at position 710; the E-value for the NADH_dhqG_C domain shown below is 1.5e-19.

DIEETNYFQQASELAKLVNQEVLADPLVPPQLTIKDFYMTDSISRASQTMAKC

NADH_dhqG_C

NADH_dhqG_C
PFAM accession number:PF09326
Interpro abstract (IPR015405):

This C-terminal domain is functionally uncharacterised and is found in various prokaryotic NADH dehydrogenases including NADH-quinone oxidoreductase, chain G.

GO process:oxidation-reduction process (GO:0055114)
GO function:iron-sulfur cluster binding (GO:0051536), oxidoreductase activity, acting on NAD(P)H (GO:0016651)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NADH_dhqG_C