The domain within your query sequence starts at position 658 and ends at position 710; the E-value for the NADH_dhqG_C domain shown below is 1.5e-19.
DIEETNYFQQASELAKLVNQEVLADPLVPPQLTIKDFYMTDSISRASQTMAKC
NADH_dhqG_C |
![]() |
---|
PFAM accession number: | PF09326 |
---|---|
Interpro abstract (IPR015405): | This C-terminal domain is functionally uncharacterised and is found in various prokaryotic NADH dehydrogenases including NADH-quinone oxidoreductase, chain G. |
GO process: | oxidation-reduction process (GO:0055114) |
GO function: | iron-sulfur cluster binding (GO:0051536), oxidoreductase activity, acting on NAD(P)H (GO:0016651) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NADH_dhqG_C