The domain within your query sequence starts at position 1 and ends at position 84; the E-value for the NADHdh_A3 domain shown below is 1.2e-54.
MAGRISAFLKNAWAKEPVLVVSFSVWGLAIIMPMISPYTKYASMINKATPYNYPVPVRDD GNMPDVPSHPQDPLGPSLDWLKNL
NADHdh_A3 |
---|
PFAM accession number: | PF14987 |
---|---|
Interpro abstract (IPR026626): | NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 is a accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (complex I), that is believed not to be involved in catalysis [ (PUBMED:7958365) ]. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone [ (PUBMED:1518044) (PUBMED:16828987) ]. |
GO component: | mitochondrial inner membrane (GO:0005743), mitochondrial respiratory chain complex I (GO:0005747) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NADHdh_A3