The domain within your query sequence starts at position 1 and ends at position 84; the E-value for the NADHdh_A3 domain shown below is 1.2e-54.

MAGRISAFLKNAWAKEPVLVVSFSVWGLAIIMPMISPYTKYASMINKATPYNYPVPVRDD
GNMPDVPSHPQDPLGPSLDWLKNL

NADHdh_A3

NADHdh_A3
PFAM accession number:PF14987
Interpro abstract (IPR026626): NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 is a accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (complex I), that is believed not to be involved in catalysis [(PUBMED:7958365)]. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone [(PUBMED:1518044), (PUBMED:16828987)].
GO component:mitochondrial inner membrane (GO:0005743), mitochondrial respiratory chain complex I (GO:0005747)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NADHdh_A3